207601

ERH (DROER, FLJ27340, Enhancer of Rudimentary Homolog (Drosophila))

Größe

£685.00

SKU:: 207601
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-104 from full-length human ERH with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: May have a role in the cell cycle. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYE EHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADT QTYQPYNKDWIKEKIYVLLRRQAQQAGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.