207524-FITC

CAPZB (F-actin-capping Protein Subunit beta, Capping Protein (actin filament) Muscle Z-line beta) CAPB, CAPPB, CAPZ, MGC104401, MGC129749, MGC129750 (FITC)

Größe

£914.00

SKU:: 207524-FITC
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa192-272 from human CAPZB with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLN EIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALK RKQQC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.