207523

CAPG (Capping Protein (actin filament), Gelsolin-like, AFCP, MCP, Actin-regulatory Protein CAP-G, Gelsolin-like Capping Protein, Macrophage Capping Protein)

Größe

£685.00

SKU:: 207523
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa249-348 from human CAPG with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed, but have not been fully described. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLD NGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYA PNTQVEILPQGHESPIFKQFFKDWK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.