TNFRSF4, Recombinant, Human (Tumor Necrosis Factor Receptor Superfamily Member 4, OX40, CD134)

Größe

£868.00

SKU:: 172359
Molekulargewicht:: 46.8
Reinheit:: ~90%
Lagerbedingungen:: -70°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Weitere Details:: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity. Source: Recombinant Fc fusion protein corresponding to aa29-216 from human OX40, expressed in HEK293 cell expression system. Molecular Weight: ~46.8kD AA Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKP CTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDN QACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEA WPRTSQGPSTRPVEVPGGRAV AIEGRMDPKSCDKTHTCPPCP APELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK Endotoxin: <0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.