172332
Frizzled-7, Recombinant, Huma, FC Fustion (FZD7, Frizzled 7)
Größe
£900.00
- SKU:
- 172332
- Molekulargewicht:
- 43.3
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -70°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a liquid in 40mM Tris, pH 8.0, 110mM sodium chloride, 2.2mM KCl, 20% glycerol.
- Weitere Details:
- Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Recombinant protein corresponding to aa33-185 from human Frizzled-7, fused to C-terminal Fc fusion (Human IgG1), expressed in HEK293 cell expression system. Swiss/Uniprot: O75084 Molecular Weight: ~43.3kD, runs at a higher apparent molecular weight by SDS-PAGE due to glycosylation. DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Applications: Suitable for use in binding studies, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Dry Ice