CD27, Recombinant, Human (Tumor Necrosis Factor Receptor Superfamily Member 7, TNFRSF7, T14)

Größe

£868.00

SKU:: 172322
Molekulargewicht:: 45.8
Reinheit:: ~90%
Lagerbedingungen:: -70°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol.
Weitere Details:: Receptor for CD70/CD27L. May play a role in survival of activated T-cells. May play a role in apoptosis through association with SIVA1. Source: Recombinant protein corresponding to aa21-192 from human CD27 expressed in HEK293 cell expression system. Molecular Weight: ~45.8kD AA Sequence: TPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHH TRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARS SQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSD FIRIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK* Endotoxin: ≤0.1EU/ug Applications: Suitable for use in studying protein binding and screening small molecules. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.