B7-H4, Recombinant, Human, His-Tag (B7x, B7S1, B7H4)

Größe

£714.00

SKU:: 172315
Molekulargewicht:: 26.7
Reinheit:: ~90%
Lagerbedingungen:: -70°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.4mM KCl, 20% glycerol.
Weitere Details:: Human secreted B7-H4, also known as B7x and B7S1. Source: Recombinant protein corresponding to aa29-258 from human B7-H4 at C-terminal, fused to His-tag, expressed in HEK293 cell expression system. Molecular Weight: ~26.7kD AA Sequence: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKD ELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYK TGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELN SENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAHHH HHHHHHH Endotoxin: <0.1EU.ug Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.