COX1, Recombinant, Human, aa1-599 (Cyclooxygenase-1, Prostaglandin-Endoperoxide Synthase 1, Prostaglandin G/H Synthase and Cyclooxygenase, PTGS1, PES-1, PGHS-1, Prostaglandin H2 Synthase 1, PTGHS)

Größe

£413.00

SKU:: 171851
Molekulargewicht:: 70.5
Reinheit:: ~90%
Lagerbedingungen:: -70°C
Hersteller:: United States Biological
Format:: Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM KCl, 0.04% Tween 20, 80ug/ml FLAG peptide, 300um diethyldithiocarbamate, 20% glycerol.
Weitere Details:: Recombinant protein corresponding to a.a.1-599 (end) human COX1 with C-terminal FLAG-His-tag, expressed in a baculovirus infected Sf9 cell expression system. GenBank Accession: NM_000962 Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Assay Description: Mixed various concentrations of enzyme in Assay buffer (100mM Tris-HCl pH 8,3uM EDTA) with 5uM Hematin for 10 minutes then added 100_x0001_M Ampliflu Red and 200uM arachidonic acid. Fluorescence (ex. 535 em. 590) was measured after 5 minutes at RT. Reaction volume was 100ul. Amino Acid Sequence: MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCT RTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTV RSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLA RRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGD NLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFG LLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSG YFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTS MLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFG MKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSL KGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDG PAVERPSTELDYKDDDDKHHHHHH Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Dry Ice