168763-AF-PE
DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A) (PE)
Größe
£876.00
- SKU:
- 168763-AF-PE
- Reinheit:
- Purified by Protein A/G affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). Cellular Localization: Cell Surface and Cytoplasmic
- Klon:
- DG1/447, DOG-1.1
- Format:
- Supplied as a liquid in 10mM PBS. No preservative added. BSA-Free. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%. Applications: Suitable for use in Immunofluorescence, Flow Cytometry, Western Blot, Immunoprecipitation, Immunohistochemistry. Other applications not tested. Recommended Dilution: Flow Cytometry: 0.5-1ug/million cells Immunofluorescence: 0.5-1ug/ml Western Blot: 0.5-1.0ug/ml Immunoprecipitation: 0.5-1ug/500ug protein lysate Immunohistochemistry: Frozen & Formalin-fixed: 0.5-1ug/ml for 30 minutes at RT (Staining of formalin-fixed tissues requires boiling tissue sections in 10mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes Optimal dilutions to be determined by the researcher. Positive Control: Gastrointestinal Stromal Tumor: GIST or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice