156924
Suppressor of Tumorigenicity 14 (ST14) Recombinant, Human
Größe
£366.00
- SKU:
- 156924
- Molekulargewicht:
- 32.9
- Reinheit:
- ≥97% (by SDS-PAGE under reducing conditions). Endotoxin: ≤1EU/ug (LAL method)
- Lagerbedingungen:
- 4°C/-70°C
- Hersteller:
- United States Biological
- Format:
- Supplied as a powder lyophilized from a solution containing Tris-saline, pH 8, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and 0.01% Proclin-300.
- Weitere Details:
- Source: Recombinant Human from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q9Y5Y6 Fragment: Arg607~Asn852 (Accession No: Q9Y5Y6) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-RSFTRQARVV GGTDADEGEW PWQVSLHALG QGHICGASLI SPNWLVSAAH CYIDDRGFRY SDPTQWTAFL GLHDQSQRSA PGVQERRLKR IISHPFFNDF TFDYDIALLE LEKPAEYSSM VRPICLPDAS HVFPAGKAIW VTGWGHTQYG GTGALILQKG EIRVINQTTC ENLLPQQITP RMMCVGFLSG GVDSCQGDSG GPLSSVEADG RIFQAGVVSW GDGCAQRNKP GVYTRLPLFR DWIKEN Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 32.9kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Versandbedingungen:
- Blue Ice