154788
Glutamate Decarboxylase 2, Acid (GAD2) Recombinant, Rat
Größe
£371.00
- SKU:
- 154788
- Molekulargewicht:
- 21.9
- Reinheit:
- ≥95%
- Lagerbedingungen:
- 4°C/-70°C
- Hersteller:
- United States Biological
- Format:
- Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2.
- Weitere Details:
- Source: Recombinant Rat from E. coli Accession No: Q05683 Fragment: Met1~Ala150 (Accession No: Q05683) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASPGSGFWS FGSEDGSGDP ENPGTARAW C QVAQKFTGGI GNKLCALLYG DSEKPAESGG SVTSRAATRK VACTCDQKPC SCPKGDVNYA LLHATDLLPA CEGERPTLAF LQDVMNILLQ YVVKSFDRST KVIDFHYPNE LLQEYNWELA Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 21.9kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Versandbedingungen:
- Blue Ice