TNFSF14, Recombinant, Human (Tumor Necrosis Factor Ligand Superfamily Member 14, CD258, Herpes Virus Entry Mediator Ligand, Herpes virus Entry Mediator Ligand, HVEML, HVEM-L, LIGHT, LTg, TR2, UNQ391/PRO726)

Größe

£320.00

SKU:: 143425
Reinheit:: ≥95% by SDS-PAGE gel and HPLC analyses. Endotoxin: ≤0.1ng/ug of protein (<1EU/ug).
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with sterile ddH2O, , 0.1% BSA or HSA to a concentration of 0.1-1.0mg/ml. Do not vortex.
Weitere Details:: LIGHT belongs to the TNF family of ligands, and can signal through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LT beta R, or bind to a decoy receptor, DcR3. It is expressed in splenocytes, activated PBL, CD+8 tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT has the ability to active NFkappaB, to co-stimulate the activation of lymphocytes and to induce apoptosis in certain human tumor cells. Recombinant human LIGHT has a calculated mass of 19.3kD containing 177aa residues. Due to glycosylation LIGHT migrates between 20-22.5kD by SDS-PAGE under non-reducing conditions. Biological Activity: Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-gamma. Amino Acid Sequence: RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Versandbedingungen:: Blue Ice