TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25) (Biotin)

Größe

£1,000.00

SKU:: 138440-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of TMED4 corresponding to LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.