138389-BIOTIN
SNF1LK (Serine/Threonine Protein Kinase SIK1, Salt-inducible Protein Kinase 1, SIK-1, Serine/Threonine-protein Kinase SNF1-like Kinase 1, Serine/Threonine-protein Kinase SNF1LK, SIK1, SIK) (Biotin)
Größe
£1,000.00
- SKU:
- 138389-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- N-terminus of SNF1LK corresponding to MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice