SLC46A3 (Solute Carrier Family 46 Member 3, FKSG16, DKFZp686A1775, FLJ42613)

Größe

£744.00

SKU:: 138379
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Snthetic peptide corresponding to MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC near the N-terminus of human SLC46A3. Species Sequence Homology: mouse, rat, canine and rabbit
Format:: Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose.
Weitere Details:: The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.