138375-FITC

SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4) (FITC)

Größe

£1,000.00

SKU:: 138375-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Middle region of SLC38A4 corresponding to LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: SLC38A4 is found predominantly in liver and transports both cationic and neutral aa. The transport of cationic aa by SLC38A4 is Na(+) and pH independent, while the transport of neutral aa is Na(+) and pH dependent. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.