SLC35C1 (GDP-fucose Transporter 1, Solute Carrier Family 35 Member C1, FUCT1, CDG2C, FLJ11320, FLJ14841)

Größe

£744.00

SKU:: 138369
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG corresponding to the N-terminal region of human SLC35C1. Species Sequence Homology: bovine, canine, guinea pig, equine, mouse, porcine, rabbit and rat
Format:: Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose
Weitere Details:: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.