138368-APC
SLC35B1 (Solute Carrier Family 35 Member B1, UDP-galactose Transporter-related Protein 1, UGTrel1, hUGTrel1, UGTREL1) (APC)
Größe
£1,000.00
- SKU:
- 138368-APC
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- C-terminus of SLC35B1 corresponding to ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice