SLC22A16 (Solute Carrier Family 22 Member 16, Carnitine Transporter 2, CT2, Fly-like Putative Transporter 2, FLIPT2, Flipt 2, Organic Cation Transporter OKB1, Organic Cation/Carnitine Transporter 6, OCT6)

Größe

£744.00

SKU:: 138353
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR (N-terminal) from human SLC22A16.
Format:: Supplied as a liquid in PBS, pH 7.2, 2% sucrose, 0.09% sodium azide.
Weitere Details:: Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs). Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications have not been tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.