Sirtuin 5 (SIRT5, NAD-dependent Protein Deacylase Sirtuin-5, Mitochondrial, Regulatory Protein SIR2 Homolog 5, SIR2-like Protein 5, SIR2L5) (HRP)

Größe

£1,000.00

SKU:: 138339-HRP
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: C-terminus of SIRT5 corresponding to HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.