138287-FITC

RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (FITC)

Größe

£1,000.00

SKU:: 138287-FITC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Middle region of RHAG corresponding to FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice