SILV (PMEL, Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV)

Größe

£744.00

SKU:: 138224
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY from the N-terminal region of human SILV. Species Sequence Homology: bovine, canine, goat, guinea pig, equine, mouse,, rabbit and rat.
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity. Applications: Suitable for use in Immunoprecipitation, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml Immunoprecipitation: 1:200 Immunohistochemistry: 1.25ug/ml using HepG2 cell lysates. Gel concentration: 12% Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.