PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (PE)

Größe

£1,000.00

SKU:: 138224-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY from the N-terminal region of human SILV. Species Sequence Homology: bovine, canine, goat, guinea pig, equine, mouse,, rabbit and rat.
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity. Applications: Suitable for use in Immunoprecipitation, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice