138220-APC

PIGV (GPI Mannosyltransferase 2, GPI Mannosyltransferase II, Phosphatidylinositol-glycan Biosynthesis Class V Protein, PIG-V, FLJ20477) (APC)

Größe

£1,000.00

SKU:: 138220-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of PIGV corresponding to FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.