138006-ML650

GOT2 (Aspartate Aminotransferase, Mitochondrial, mAspAT, Fatty Acid-binding Protein, FABP-1, Glutamate Oxaloacetate Transaminase 2, Kynurenine Aminotransferase 4, Kynurenine Aminotransferase IV, Kynurenine--oxoglutarate Transaminase 4, Kynurenine--oxoglutarate Transaminase IV, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A, FLJ40994, KAT4, KATIV) (MaxLight 650)

Größe

£1,000.00

SKU:: 138006-ML650
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Weitere Details:: MaxLight™ 650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in aa metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice