138006-APC

GOT2 (Aspartate Aminotransferase, Mitochondrial, mAspAT, Fatty Acid-binding Protein, FABP-1, Glutamate Oxaloacetate Transaminase 2, Kynurenine Aminotransferase 4, Kynurenine Aminotransferase IV, Kynurenine--oxoglutarate Transaminase 4, Kynurenine--oxoglutarate Transaminase IV, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A, FLJ40994, KAT4, KATIV) (APC)

Größe

£1,000.00

SKU:: 138006-APC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to PPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in aa metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.