GOT2 (Aspartate Aminotransferase, Mitochondrial, mAspAT, Fatty Acid-binding Protein, FABP-1, Glutamate Oxaloacetate Transaminase 2, Kynurenine Aminotransferase 4, Kynurenine Aminotransferase IV, Kynurenine--oxoglutarate Transaminase 4, Kynurenine--oxoglutarate Transaminase IV, Plasma Membrane-associated Fatty Acid-binding Protein, FABPpm, Transaminase A, FLJ40994, KAT4, KATIV)

Größe

£744.00

SKU:: 138005
Reinheit:: Purified by affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in aa metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.