137998-APC

Glutamic Pyruvic Transaminase (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (APC)

Größe

£864.00

SKU:: 137998-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide directed toward the N terminal region, RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT, of human GPT. Species Homology: mouse, rat, cow, guinea pig, and canine.
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.