FCRL1 (Fc Receptor-like Protein 1, FcR-like Protein 1, FcRL1, Fc Receptor Homolog 1, FcRH1, IFGP Family Protein 1, hIFGP1, Immune Receptor Translocation-associated Protein 5, CD307a, FCRH1, IFGP1, IRTA5, DKFZp667O1421) (FITC)

Größe

£1,000.00

SKU:: 137949-FITC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of FCRL1 corresponding to MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.