137932-ML490
ELOVL7 (Elongation of Very Long Chain Fatty Acids Protein 7, 3-keto Acyl-CoA Synthase ELOVL7, ELOVL Fatty Acid Elongase 7, ELOVL FA Elongase 7, Very-long-chain 3-oxoacyl-CoA Synthase 7, FLJ23563) (MaxLight 490)
Größe
£1,000.00
- SKU:
- 137932-ML490
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to the region MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS from human ELOVL7 at N-terminal. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine and rabbit
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™ 490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice