137932-FITC

ELOVL7 (Elongation of Very Long Chain Fatty Acids Protein 7, 3-keto Acyl-CoA Synthase ELOVL7, ELOVL Fatty Acid Elongase 7, ELOVL FA Elongase 7, Very-long-chain 3-oxoacyl-CoA Synthase 7, FLJ23563) (FITC)

Größe

£1,000.00

SKU:: 137932-FITC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to the region MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS from human ELOVL7 at N-terminal. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine and rabbit
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.