DLAT (Dihydrolipoyllysine-residue Acetyltransferase Component of Pyruvate Dehydrogenase Complex, Mitochondrial, 70kD Mitochondrial Autoantigen of Primary Biliary Cirrhosis, PBC, Dihydrolipoamide Acetyltransferase Component of Pyruvate Dehydrogenase Complex, M2 Antigen Complex 70kD Subunit, Pyruvate Dehydrogenase Complex Component E2, PDC-E2, PDCE2, DLTA)

Größe

£744.00

SKU:: 137923
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR from the N-terminal of human DLAT. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine, rabbit and zebrafish
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Weitere Details:: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.