Cytokeratin 18 (Cytokeratin-18, CK 18, CK18, CK-18, CYK18, Cytokeratin endo B, Cell Proliferation-inducing Gene 46 Protein, K18, Keratin 18, Keratin-18, Keratin Type I Cytoskeletal 18, KRT18, Keratin D, Kerd, PIG46)

Größe

£744.00

SKU:: 137912
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: C-terminus of KRT18 corresponding to ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV
Format:: Supplied as a lyophilized powder in PBS. Reconstitute with 100ul sterile dH2O.
Weitere Details:: KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.