137855
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2b)
Größe
£744.00
- SKU:
- 137855
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- C-terminus of CLIC2 corresponding to SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice