137845
CLDN10 (Claudin 10, Claudin-10, OSP-like Protein)
Größe
£744.00
- SKU:
- 137845
- Anwendung:
- WB
- Reinheit:
- Purified by affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- C-terminus of CLDN10 corresponding to MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
- Format:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Weitere Details:
- CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice