ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1)

Größe

£685.00

SKU:: 135543
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2811-2910 from human ZFHX3 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: ATBF1 is a transcription factor that negatively regulates alpha fetoprotein and MYB, transactivates CDKN1A, and may be a tumor suppressor. Loss of ATBF1 is one mechanism that defines the absence of growth control in prostate cancer. Presence of the isoform ABTF1-A is correlated with better prognosis in breast cancer and may also serve as a marker of endocrine responsiveness. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.