ZFAND3 (AN1-type Zinc Finger Protein 3, Testis-expressed Sequence 27, TEX27)

Größe

£685.00

SKU:: 135541
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-61 from human ZFAND3 (NP_068762) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: FAND3, also known as AN1-type zinc finger protein 3, contains DNA-binding domain and has a wide variety of functions, most of which encompass some form of transcriptional activation or repression. ZFAND3 is a 251aa protein containing two AN1-type zinc fingers and two UIM (ubiquitin-interacting motif) repeats. Conserved in animals and plants, the AN1-type zinc finger domain is often found in proteins that contain a ubiquitin- like domain, which suggests a role in the ubiquitination pathway. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.