135505-ML490

ZBP1 (Insulin-like Growth Factor 2 mRNA-binding Protein 1, IGF2 mRNA-binding Protein 1, IMP-1, Coding Region Determinant-binding Protein, CRD-BP, IGF-II mRNA-binding Protein 1, VICKZ Family Member 1, Zip Code-binding Protein 1, ZBP-1, Zipcode-binding Protein 1, IGF2BP1, CRDBP, VICKZ1) (MaxLight 490)

Größe

£914.00

SKU:: 135505-ML490
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-101 from human ZBP1 (NP_110403) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Weitere Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. ZBP1 binds to cytoplasmic DNA and plays a role in host defense against tumors and pathogens. Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice