XCL1 (Lymphotactin, ATAC, C Motif Chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible Cytokine C1, XC Chemokine Ligand 1, LTN, SCYC1)

Größe

£685.00

SKU:: 135437
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-114 from human XCL1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1E1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Chemotactic activity for lymphocytes but not for monocytes or neutrophils. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.