WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105)

Größe

£685.00

SKU:: 135416
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa70-151 from human WTAP with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.