WFDC2 (WAP Four-disulfide Core Domain Protein 2, Epididymal Secretory Protein E4, HE4, Major Epididymis-specific Protein E4, Putative Protease Inhibitor WAP5, EDDM4, dJ461P17.6)

Größe

£685.00

SKU:: 135376
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa31-124 from WFDC2 (AAH46106) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.