135268-FITC

VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (FITC)

Größe

£914.00

SKU:: 135268-FITC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa24-124 from human VPREB3 (NP_037510) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H8
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.