135210-BIOTIN
Vascular Endothelial Growth Factor Receptor 2 (VEGF Receptor 2, VEGFR 2, VEGFR2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1) (Biotin)
Größe
£914.00
- SKU:
- 135210-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa31-130 from human KDR (NP_002244) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2A2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- VEGFR2 is the major VEGF receptor in human malignancies. VEGFR2 is highly expressed in colon cancer endothelium and relates to increased tumor vascularity and high metastatic ability. Binding of VEGF to VEGFR2 on endothelial cells results in receptor phosphorylation and triggering of a cascade of events leading to endothelial cell proliferation, migration, apoptosis inhibition and maturation of vascular structures. Human VEGFR2 gene is mapped to chromosome 4q11-q12. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice