VAPB (Vesicle-associated Membrane Protein-associated Protein B/C, VAMP-associated Protein B/C, VAMP-B, VAMP-B/VAMP-C, VAP-B, VAP-B/VAP-C, UNQ484/PRO983, ALS8) (Not for Export EU)

Größe

£760.00

SKU:: 135206
Reinheit:: Serum
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human VAPB, aa1-243 (NP_004729.1)
Format:: Supplied as a liquid.
Weitere Details:: Applications: Suitable for use in Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.