USP9X (Ubiquitin-specific Protease 9, X Chromosome, USP9, Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-X, Deubiquitinating Enzyme FAF-X, DFFRX, Fat Facets in Mammals, FAM, hFAM, Fat Facets Protein-related, X-linked, Ubiquitin Thioesterase FAF-X, Ubiquitin-specific-processing Protease FAF-X)

Größe

£685.00

SKU:: 135185
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91 from USP9X (NP_068706) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.