135175-PE

USP4 (Ubiquitin-specific-processing Protease 4, Ubiquitin Carboxyl-terminal Hydrolase 4, Deubiquitinating Enzyme 4, Ubiquitin Thioesterase 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (PE)

Größe

£914.00

SKU:: 135175-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa676-773 from human USP4 (NP_003354) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 10ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.