USP20 (Ubiquitin-specific-processing Protease 20, Ubiquitin Carboxyl-terminal Hydrolase 20, Deubiquitinating Enzyme 20, Ubiquitin Thioesterase 20, VHL-interacting Deubiquitinating Enzyme 2, VDU2, hVDU2, KIAA1003, LSFR3A)

Größe

£685.00

SKU:: 135162
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa252-349 from human USP20 (NP_001008563) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.