USH1C (Usher Syndrome Type-1C Protein, Harmonin, Antigen NY-CO-38/NY-CO-37, Autoimmune Enteropathy-related Antigen AIE-75, AIE75, Protein PDZ-73, PDZ73, Renal Carcinoma Antigen NY-REN-3)

Größe

£685.00

SKU:: 135143
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa424-533 from USH1C (AAH16057) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEADAALQKAWNQGGDWIDLVVAVCPPKEYDDELTFF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.