UNC5B (Protein Unc-5 Homolog B, Netrin Receptor UNC5B, Protein Unc-5 Homolog 2, UNC5H2, p53-regulated Receptor for Death and Life Protein 1, P53RDL1, UNQ1883/PRO4326)

Größe

£685.00

SKU:: 135106
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa27-127 from human UNC5B (NP_734465) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: GTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.