135084-BIOTIN
UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, RING Finger Protein 107, RNF107) (Biotin)
Größe
£914.00
- SKU:
- 135084-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa81-181 from human UHRF2 (NP_690856) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice